RAD18 anticorps

N° du produit ABIN631295

L’anticorps anti-RAD18 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de RAD18 dans des échantillons provenant de Humain. }

Aperçu rapide pour RAD18 anticorps (ABIN631295)

Antigène: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAD18 anticorps

Purification: Affinity purified

Immunogène: RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD18 Blocking Peptide, (ABIN5615730), is also available for use as a blocking control in assays to test for specificity of this RAD18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD18

Antigène: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Autre désignation: RAD18

Sujet: RAD18 is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA.

Poids moléculaire: 56 kDa (MW of target protein)