KDM4B anticorps (Middle Region)
-
- Antigène Voir toutes KDM4B Anticorps
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KDM4B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- JMJD2 B antibody was raised against the middle region of JMJD2
- Purification
- Affinity purified
- Immunogène
- JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK
- Top Product
- Discover our top product KDM4B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
JMJD2B Blocking Peptide, catalog no. 33R-2124, is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
- Autre désignation
- JMJD2B (KDM4B Produits)
- Synonymes
- anticorps KDM4B, anticorps JMJD2B, anticorps jmjd2b, anticorps si:ch211-124a3.4, anticorps TDRD14B, anticorps 4732474L06Rik, anticorps Jmjd2b, anticorps mKIAA0876, anticorps lysine demethylase 4B, anticorps lysine (K)-specific demethylase 4B, anticorps KDM4B, anticorps kdm4b, anticorps Kdm4b
- Sujet
- JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.
- Poids moléculaire
- 122 kDa (MW of target protein)
- Pathways
- L'effet Warburg
-