UBE2K anticorps

N° du produit ABIN631297

Cet anticorps Lapin Polyclonal détecte spécifiquement UBE2K dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UBE2K anticorps (ABIN631297)

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2K est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2K anticorps

Purification: Affinity purified

Immunogène: UBE2 K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2K Blocking Peptide, (ABIN5616870), is also available for use as a blocking control in assays to test for specificity of this UBE2K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2K

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Autre désignation: UBE2K

Sujet: UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.

Poids moléculaire: 22 kDa (MW of target protein)