UBE2L6 anticorps (Middle Region)

N° du produit ABIN631352

L’anticorps anti-UBE2L6 Polyclonal Lapin est utilisé pour la détection de UBE2L6 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour UBE2L6 anticorps (Middle Region) (ABIN631352)

Antigène: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2L6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2L6 anticorps

Épitope: Middle Region

Specificité: UBE2 L6 antibody was raised against the middle region of UBE2 6

Purification: Affinity purified

Immunogène: UBE2 L6 antibody was raised using the middle region of UBE2 6 corresponding to a region with amino acids QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2L6 Blocking Peptide, (ABIN5616875), is also available for use as a blocking control in assays to test for specificity of this UBE2L6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2L6

Antigène: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Autre désignation: UBE2L6

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.

Poids moléculaire: 18 kDa (MW of target protein)