FBXW11 anticorps (N-Term)

N° du produit ABIN631368

Cet anticorps anti-FBXW11 Polyclonal Lapin (ABIN631368) détecte spécifiquement FBXW11 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour FBXW11 anticorps (N-Term) (ABIN631368)

Antigène: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXW11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXW11 anticorps

Épitope: N-Term

Specificité: FBXW11 antibody was raised against the N terminal of FBXW11

Purification: Affinity purified

Immunogène: FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXW11 Blocking Peptide, (ABIN937130), is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXW11

Antigène: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Autre désignation: FBXW11

Sujet: FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.

Poids moléculaire: 62 kDa (MW of target protein)