FBXW11 anticorps (N-Term)

N° du produit ABIN631385

Détail du produit anti-FBXW11 anticorps

Antigène: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXW11 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXW11 antibody was raised against the N terminal of FBXW11

Purification: Affinity purified

Immunogène: FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXW11 Blocking Peptide, catalog no. 33R-2627, is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXW11

Antigène: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Autre désignation: FBXW11 (FBXW11 Produits)

Synonymes: anticorps BTRC2, anticorps BTRCP2, anticorps FBW1B, anticorps FBXW1B, anticorps Fbw11, anticorps Hos, anticorps 2310065A07Rik, anticorps AA536858, anticorps Fbxw1b, anticorps HOS, anticorps btrc2, anticorps fbxw11a, anticorps wu:fa12e12, anticorps wu:fb11f03, anticorps zgc:63728, anticorps fbxw11, anticorps fbxw11b, anticorps fbxw1b, anticorps wu:fd14d12, anticorps wu:fi43f07, anticorps F-box and WD repeat domain containing 11, anticorps F-box and WD-40 domain protein 11, anticorps F-box/WD repeat-containing protein 11, anticorps F-box and WD repeat domain containing 11b, anticorps F-box and WD repeat domain containing 11a, anticorps FBXW11, anticorps Fbxw11, anticorps LOC100199403, anticorps fbxw11b, anticorps fbxw11a

Sujet: FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Poids moléculaire: 61 kDa (MW of target protein)