Klotho anticorps (N-Term)

N° du produit ABIN631412

Détail du produit anti-Klotho anticorps

Antigène: Klotho (KL)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Klotho est non-conjugé

Application: Western Blotting (WB)

Specificité: Klotho antibody was raised against the n terminal of KL

Purification: Affinity purified

Immunogène: Klotho antibody was raised using the N terminal of KL corresponding to a region with amino acids FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Klotho Blocking Peptide, catalog no. 33R-3012, is also available for use as a blocking control in assays to test for specificity of this Klotho antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Klotho

Antigène: Klotho (KL)

Autre désignation: Klotho (KL Produits)

Synonymes: anticorps alpha-kl, anticorps KL, anticorps LOC100223456, anticorps klotho, anticorps Klotho, anticorps KL, anticorps Kl, anticorps kl, anticorps LOC100533542

Sujet: This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF).

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Activity, Growth Factor Binding