Hsc70 anticorps (N-Term)

N° du produit ABIN631424

L’anticorps anti-Hsc70 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de Hsc70 dans des échantillons provenant de Humain, Rat, Souris, Chien, Drosophila melanogaster, C. elegans et Arabidopsis. }

Aperçu rapide pour Hsc70 anticorps (N-Term) (ABIN631424)

Antigène: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Reactivité: Humain, Rat, Souris, Chien, Drosophila melanogaster, C. elegans, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Hsc70 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Hsc70 anticorps

Épitope: N-Term

Specificité: HSPA8 antibody was raised against the N terminal of HSPA8

Purification: Affinity purified

Immunogène: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA8 Blocking Peptide, (ABIN5614100), is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Hsc70

Antigène: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Autre désignation: HSPA8

Sujet: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Poids moléculaire: 71 kDa (MW of target protein)