Hsc70 anticorps (N-Term)

N° du produit ABIN631424

Détail du produit anti-Hsc70 anticorps

Antigène: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien, Drosophila melanogaster, C. elegans, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Hsc70 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA8 antibody was raised against the N terminal of HSPA8

Purification: Affinity purified

Immunogène: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA8 Blocking Peptide, catalog no. 33R-6448, is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Hsc70

Antigène: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Autre désignation: HSPA8 (HSPA8 Produits)

Synonymes: anticorps hsc54, anticorps hsc70, anticorps hsc71, anticorps hsp71, anticorps hsp73, anticorps hspa10, anticorps lap1, anticorps nip71, anticorps HSC54, anticorps HSC70, anticorps HSC71, anticorps HSP71, anticorps HSP73, anticorps HSPA10, anticorps LAP1, anticorps NIP71, anticorps Hsc70, anticorps 2410008N15Rik, anticorps Hsc71, anticorps Hsc73, anticorps Hsp73, anticorps Hspa10, anticorps wu:fb01g06, anticorps wu:fi48b06, anticorps heat shock protein family A (Hsp70) member 8 L homeolog, anticorps heat shock protein family A (Hsp70) member 8, anticorps heat shock 70kDa protein 8, anticorps heat shock protein 8, anticorps hspa8.L, anticorps HSPA8, anticorps Hspa8, anticorps hspa8

Sujet: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Poids moléculaire: 71 kDa (MW of target protein)