RAB1A anticorps (Middle Region)

N° du produit ABIN631433

L’anticorps Lapin Polyclonal anti-RAB1A a été validé pour WB. Il convient pour détecter RAB1A dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour RAB1A anticorps (Middle Region) (ABIN631433)

Antigène: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB1A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB1A anticorps

Épitope: Middle Region

Specificité: RAB1 A antibody was raised against the middle region of RAB1

Purification: Affinity purified

Immunogène: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB1A Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB1A

Antigène: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Autre désignation: RAB1A

Sujet: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome