PAPSS2 anticorps (C-Term)
-
- Antigène Voir toutes PAPSS2 Anticorps
- PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAPSS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PAPSS2 antibody was raised against the C terminal of PAPSS2
- Purification
- Affinity purified
- Immunogène
- PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
- Top Product
- Discover our top product PAPSS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAPSS2 Blocking Peptide, catalog no. 33R-6976, is also available for use as a blocking control in assays to test for specificity of this PAPSS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPSS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))
- Autre désignation
- PAPSS2 (PAPSS2 Produits)
- Synonymes
- anticorps ATPSK2, anticorps BCYM4, anticorps SK2, anticorps 1810018P12Rik, anticorps AI159688, anticorps AtpsU2, anticorps Atpsk2, anticorps Sk2, anticorps bm, anticorps Papss1, anticorps id:ibd2761, anticorps papss2, anticorps sb:cb868, anticorps wu:fb12e05, anticorps zgc:55851, anticorps zgc:85655, anticorps PAPSS2, anticorps zgc:153748, anticorps 3'-phosphoadenosine 5'-phosphosulfate synthase 2, anticorps 3'-phosphoadenosine 5'-phosphosulfate synthase 2b, anticorps 3'-phosphoadenosine 5'-phosphosulfate synthase 2a, anticorps PAPSS2, anticorps Papss2, anticorps papss2b, anticorps papss2.S, anticorps LOAG_05620, anticorps papss2, anticorps papss2a
- Sujet
- Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process
-