PAPSS2 anticorps (C-Term)

N° du produit ABIN631448

L’anticorps anti-PAPSS2 Polyclonal Lapin est utilisé pour la détection de PAPSS2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PAPSS2 anticorps (C-Term) (ABIN631448)

Antigène: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAPSS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAPSS2 anticorps

Épitope: C-Term

Specificité: PAPSS2 antibody was raised against the C terminal of PAPSS2

Purification: Affinity purified

Immunogène: PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAPSS2 Blocking Peptide, (ABIN5615213), is also available for use as a blocking control in assays to test for specificity of this PAPSS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPSS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAPSS2

Antigène: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Autre désignation: PAPSS2

Sujet: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process