ALG2 anticorps

N° du produit ABIN631449

Cet anticorps anti-ALG2 est un anticorps Lapin Polyclonal détectant ALG2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ALG2 anticorps (ABIN631449)

Antigène: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALG2 anticorps

Purification: Affinity purified

Immunogène: ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALG2 Blocking Peptide, (ABIN5612019), is also available for use as a blocking control in assays to test for specificity of this ALG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG2

Antigène: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Autre désignation: ALG2

Sujet: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Poids moléculaire: 47 kDa (MW of target protein)