GALE anticorps (N-Term)

N° du produit ABIN631451

L’anticorps Lapin Polyclonal anti-GALE a été validé pour WB. Il convient pour détecter GALE dans des échantillons de Humain.

Aperçu rapide pour GALE anticorps (N-Term) (ABIN631451)

Antigène: GALE (UDP-Galactose-4-Epimerase (GALE))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALE est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GALE anticorps

Épitope: N-Term

Specificité: GALE antibody was raised against the N terminal of GALE

Purification: Affinity purified

Immunogène: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALE

Antigène: GALE (UDP-Galactose-4-Epimerase (GALE))

Autre désignation: GALE

Sujet: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process