GALE anticorps (N-Term)

N° du produit ABIN631451

Détail du produit anti-GALE anticorps

Antigène: GALE (UDP-Galactose-4-Epimerase (GALE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALE est non-conjugé

Application: Western Blotting (WB)

Specificité: GALE antibody was raised against the N terminal of GALE

Purification: Affinity purified

Immunogène: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALE Blocking Peptide, catalog no. 33R-1135, is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALE

Antigène: GALE (UDP-Galactose-4-Epimerase (GALE))

Autre désignation: GALE (GALE Produits)

Synonymes: anticorps GALE, anticorps im:7147391, anticorps wu:fb05f01, anticorps zgc:136578, anticorps F15H21.11, anticorps F15H21_11, anticorps REB1, anticorps ROOT EPIDERMAL BULGER1, anticorps ROOT HAIR DEFECTIVE 1, anticorps UDP-GLUCOSE 4-EPIMERASE, anticorps UGE4, anticorps ECK0748, anticorps galD, anticorps JW0742, anticorps SMU.888, anticorps BA5505, anticorps BA5700, anticorps VFA0352, anticorps galE, anticorps 2310002A12Rik, anticorps AI323962, anticorps 1n569, anticorps xgale, anticorps SDR1E1, anticorps UDP-galactose-4-epimerase, anticorps NAD(P)-binding Rossmann-fold superfamily protein, anticorps UDP-galactose 4-epimerase GalE, anticorps UDP-glucose 4-epimerase, anticorps UDP-glucose 4-epimerase GalE, anticorps UDP-glucose/UDP-N-acetylglucosamine 4-epimerase, anticorps galactose-4-epimerase, UDP, anticorps UDP-galactose-4-epimerase L homeolog, anticorps GALE, anticorps gale, anticorps RHD1, anticorps ECs0787, anticorps galE, anticorps galE1, anticorps galE2, anticorps STY0809, anticorps galE-2, anticorps SG0897, anticorps galD, anticorps Ent638_1250, anticorps Gale, anticorps gale.L

Sujet: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process