MAP1LC3A anticorps (N-Term)

N° du produit ABIN631468

Cet anticorps Lapin Polyclonal détecte spécifiquement MAP1LC3A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MAP1LC3A anticorps (N-Term) (ABIN631468)

Antigène: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP1LC3A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP1LC3A anticorps

Épitope: N-Term

Specificité: MAP1 LC1 antibody was raised against the N terminal of MAP1 C1

Purification: Affinity purified

Immunogène: MAP1 LC1 antibody was raised using the N terminal of MAP1 C1 corresponding to a region with amino acids MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP1LC3A Blocking Peptide, (ABIN5614647), is also available for use as a blocking control in assays to test for specificity of this MAP1LC3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 C0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP1LC3A

Antigène: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Autre désignation: MAP1LC3A

Sujet: MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Autophagy