METAP2 anticorps (N-Term)

N° du produit ABIN631470

Détail du produit anti-METAP2 anticorps

Antigène: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: METAP2 antibody was raised against the N terminal of METAP2

Purification: Affinity purified

Immunogène: METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METAP2 Blocking Peptide, catalog no. 33R-1556, is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METAP2

Antigène: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Autre désignation: METAP2 (METAP2 Produits)

Synonymes: anticorps metap2, anticorps MGC53792, anticorps METAP2, anticorps GB13458, anticorps DDBDRAFT_0190923, anticorps DDBDRAFT_0304991, anticorps DDB_0190923, anticorps DDB_0304991, anticorps 4930584B20Rik, anticorps A930035J23Rik, anticorps AI047573, anticorps AL024412, anticorps AU014659, anticorps Amp2, anticorps Mnpep, anticorps p67, anticorps p67eIF2, anticorps MAP2, anticorps MNPEP, anticorps wu:fb98h06, anticorps zgc:66250, anticorps methionyl aminopeptidase 2 L homeolog, anticorps methionyl aminopeptidase 2, anticorps methionine aminopeptidase 2, anticorps methionine aminopeptidase, anticorps methionyl aminopeptidase 2 S homeolog, anticorps methionyl aminopeptidase 2b, anticorps metap2.L, anticorps METAP2, anticorps metap2, anticorps LOC551771, anticorps CAALFM_C604080WA, anticorps Metap2, anticorps metap2.S, anticorps metap2b

Sujet: METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling