PCYT2 anticorps (Middle Region)

N° du produit ABIN631492

Détail du produit anti-PCYT2 anticorps

Antigène: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCYT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCYT2 antibody was raised against the middle region of PCYT2

Purification: Affinity purified

Immunogène: PCYT2 antibody was raised using the middle region of PCYT2 corresponding to a region with amino acids KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCYT2 Blocking Peptide, catalog no. 33R-4274, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCYT2

Antigène: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Autre désignation: PCYT2 (PCYT2 Produits)

Synonymes: anticorps ET, anticorps 1110033E03Rik, anticorps ethanolamine-phosphate cytidylyltransferase, anticorps putative ethanolamine-phosphate cytidylyltransferase, anticorps Ethanolamine-phosphate cytidylyltransferase, anticorps phosphate cytidylyltransferase 2, ethanolamine, anticorps phosphate cytidylyltransferase 2, ethanolamine L homeolog, anticorps Tc00.1047053511727.120, anticorps Tb11.01.5730, anticorps LINJ_32_0940, anticorps LOC5566800, anticorps LMJF_32_0890, anticorps EDI_013070, anticorps EDI_204270, anticorps CpipJ_CPIJ009320, anticorps Bm1_01855, anticorps pcy2, anticorps PCYT2, anticorps Pcyt2, anticorps pcyt2.L

Sujet: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 44 kDa (MW of target protein)