POLR1B anticorps

N° du produit ABIN631507

Cet anticorps Lapin Polyclonal détecte spécifiquement POLR1B dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour POLR1B anticorps (ABIN631507)

Antigène: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLR1B anticorps

Purification: Affinity purified

Immunogène: POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR1B Blocking Peptide, (ABIN5615461), is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR1B

Antigène: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Autre désignation: POLR1B

Sujet: Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.

Poids moléculaire: 128 kDa (MW of target protein)