POLR1B anticorps

N° du produit ABIN631507

Détail du produit anti-POLR1B anticorps

Antigène: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR1B Blocking Peptide, catalog no. 33R-8358, is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR1B

Antigène: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Autre désignation: POLR1B (POLR1B Produits)

Synonymes: anticorps RPOL-1l, anticorps MGC68946, anticorps 128kDa, anticorps D630020H17Rik, anticorps RPA116, anticorps RPA135, anticorps RPA2, anticorps Rpo1-2, anticorps RNA polymerase I subunit B, anticorps polymerase (RNA) I polypeptide B L homeolog, anticorps polymerase (RNA) I polypeptide B, 128kDa, anticorps polymerase (RNA) I polypeptide B, anticorps DNA-directed RNA polymerase I subunit RPA2, anticorps POLR1B, anticorps polr1b.L, anticorps polr1b, anticorps LOC100563266, anticorps LOC100634236, anticorps Polr1b

Sujet: Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.

Poids moléculaire: 128 kDa (MW of target protein)