SIRT5 anticorps (Middle Region)

N° du produit ABIN631515

Cet anticorps anti-SIRT5 Polyclonal Lapin (ABIN631515) détecte spécifiquement SIRT5 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SIRT5 anticorps (Middle Region) (ABIN631515)

Antigène: SIRT5 (Sirtuin 5 (SIRT5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIRT5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIRT5 anticorps

Épitope: Middle Region

Specificité: SIRT5 antibody was raised against the middle region of SIRT5

Purification: Affinity purified

Immunogène: SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIRT5 Blocking Peptide, (ABIN5616160), is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIRT5

Antigène: SIRT5 (Sirtuin 5 (SIRT5))

Autre désignation: SIRT5

Sujet: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing. and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome