FNTA anticorps (N-Term)

N° du produit ABIN631529

L’anticorps anti-FNTA Polyclonal Lapin est utilisé pour la détection de FNTA dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FNTA anticorps (N-Term) (ABIN631529)

Antigène: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FNTA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FNTA anticorps

Épitope: N-Term

Specificité: FNTA antibody was raised against the N terminal of FNTA

Purification: Affinity purified

Immunogène: FNTA antibody was raised using the N terminal of FNTA corresponding to a region with amino acids MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FNTA Blocking Peptide, (ABIN5613630), is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FNTA

Antigène: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Autre désignation: FNTA

Sujet: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling