CDYL2 anticorps (N-Term)

N° du produit ABIN631545

Détail du produit anti-CDYL2 anticorps

Antigène: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDYL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDYL2 antibody was raised against the N terminal of CDYL2

Purification: Affinity purified

Immunogène: CDYL2 antibody was raised using the N terminal of CDYL2 corresponding to a region with amino acids NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDYL2 Blocking Peptide, catalog no. 33R-6826, is also available for use as a blocking control in assays to test for specificity of this CDYL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDYL2

Antigène: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Autre désignation: CDYL2 (CDYL2 Produits)

Synonymes: anticorps 1700029M19Rik, anticorps 4930453I21Rik, anticorps Gm20194, anticorps PCCP1, anticorps chromodomain Y-like 2, anticorps chromodomain Y like 2, anticorps chromodomain protein, Y chromosome-like 2, anticorps CDYL2, anticorps cdyl2, anticorps Cdyl2

Sujet: CDYL2 contains 1 chromo domain. The exact function of CDYL2 remains unknown.

Poids moléculaire: 56 kDa (MW of target protein)