RABGGTA anticorps (N-Term)

N° du produit ABIN631549

Détail du produit anti-RABGGTA anticorps

Antigène: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABGGTA est non-conjugé

Application: Western Blotting (WB)

Specificité: RABGGTA antibody was raised against the N terminal of RABGGTA

Purification: Affinity purified

Immunogène: RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABGGTA Blocking Peptide, catalog no. 33R-2527, is also available for use as a blocking control in assays to test for specificity of this RABGGTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABGGTA

Antigène: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Autre désignation: RABGGTA (RABGGTA Produits)

Synonymes: anticorps gm, anticorps PTAR3, anticorps Rab geranylgeranyl transferase, a subunit, anticorps Rab geranylgeranyltransferase alpha subunit, anticorps Rab geranylgeranyltransferase, alpha subunit, anticorps Rabggta, anticorps RABGGTA

Sujet: RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Poids moléculaire: 65 kDa (MW of target protein)