POLQ anticorps

N° du produit ABIN631551

Cet anticorps anti-POLQ est un anticorps Lapin Polyclonal détectant POLQ dans WB. Adapté pour Humain.

Aperçu rapide pour POLQ anticorps (ABIN631551)

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLQ est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLQ anticorps

Purification: Affinity purified

Immunogène: POLQ antibody was raised using a synthetic peptide corresponding to a region with amino acids SATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLQ Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this POLQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLQ

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Autre désignation: POLQ

Sujet: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Poids moléculaire: 180 kDa (MW of target protein)