POLQ anticorps

N° du produit ABIN631551

Détail du produit anti-POLQ anticorps

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLQ est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: POLQ antibody was raised using a synthetic peptide corresponding to a region with amino acids SATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLQ Blocking Peptide, catalog no. 33R-8319, is also available for use as a blocking control in assays to test for specificity of this POLQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLQ

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Autre désignation: POLQ (POLQ Produits)

Synonymes: anticorps POLH, anticorps PRO0327, anticorps A430110D14Rik, anticorps DNA polymerase theta, anticorps polymerase (DNA directed), theta, anticorps POLQ, anticorps polq, anticorps LOC100179525, anticorps Polq

Sujet: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Poids moléculaire: 180 kDa (MW of target protein)