GLO1 anticorps (N-Term)

N° du produit ABIN631567

Cet anticorps Lapin Polyclonal détecte spécifiquement GLO1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour GLO1 anticorps (N-Term) (ABIN631567)

Antigène: GLO1 (Glyoxalase I (GLO1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLO1 anticorps

Épitope: N-Term

Specificité: GLO1 antibody was raised against the N terminal of GLO1

Purification: Affinity purified

Immunogène: GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLO1 Blocking Peptide, (ABIN5613783), is also available for use as a blocking control in assays to test for specificity of this GLO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLO1

Antigène: GLO1 (Glyoxalase I (GLO1))

Autre désignation: GLO1

Sujet: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Poids moléculaire: 21 kDa (MW of target protein)