RPL13A anticorps (Middle Region)

N° du produit ABIN631597

Cet anticorps Lapin Polyclonal détecte spécifiquement RPL13A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RPL13A anticorps (Middle Region) (ABIN631597)

Antigène: RPL13A (Ribosomal Protein L13a (RPL13A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL13A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPL13A anticorps

Épitope: Middle Region

Specificité: RPL13 A antibody was raised against the middle region of RPL13

Purification: Affinity purified

Immunogène: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL13A Blocking Peptide, (ABIN939110), is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL13A

Antigène: RPL13A (Ribosomal Protein L13a (RPL13A))

Autre désignation: RPL13A

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 22 kDa (MW of target protein)