RPL13A anticorps (Middle Region)

N° du produit ABIN631597

Détail du produit anti-RPL13A anticorps

Antigène: RPL13A (Ribosomal Protein L13a (RPL13A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL13A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL13 A antibody was raised against the middle region of RPL13

Purification: Affinity purified

Immunogène: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL13A Blocking Peptide, catalog no. 33R-3724, is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL13A

Antigène: RPL13A (Ribosomal Protein L13a (RPL13A))

Autre désignation: RPL13A (RPL13A Produits)

Synonymes: anticorps 1810026N22Rik, anticorps Tstap198-7, anticorps tum-antigen, anticorps L13A, anticorps TSTA1, anticorps CG1475, anticorps Dmel\\CG1475, anticorps L13a2, anticorps M(3)83B, anticorps Rp L13A, anticorps anon-EST:Posey125, anticorps anon-EST:fe1A5, anticorps bs25f04.y1, anticorps cg1475, anticorps MGC54018, anticorps GB16111, anticorps hm:zehp0384, anticorps wu:fa95e06, anticorps wu:fb08g07, anticorps wu:fd05d08, anticorps DDBDRAFT_0217704, anticorps DDBDRAFT_0231192, anticorps DDB_0217704, anticorps DDB_0231192, anticorps ribosomal protein L13A, anticorps ribosomal protein L13a, anticorps Ribosomal protein L13A, anticorps ribosomal protein L13a S homeolog, anticorps 60S ribosomal protein L13a, anticorps ribosomal protein 13a, anticorps ribosomal 60S subunit protein L13A, anticorps Ribosomal protein L13a, component of cytosolic 80S ribosome and 60S large subunit, anticorps S60 ribosomal protein L13a, anticorps Rpl13a, anticorps RPL13A, anticorps RpL13A, anticorps rpl13a.S, anticorps rpl13a, anticorps LOC551418, anticorps LOC663151, anticorps RPL13a

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 22 kDa (MW of target protein)