alpha KGDHC anticorps (N-Term)

N° du produit ABIN631602

Cet anticorps anti-alpha KGDHC est un anticorps Lapin Polyclonal détectant alpha KGDHC dans WB. Adapté pour Humain.

Aperçu rapide pour alpha KGDHC anticorps (N-Term) (ABIN631602)

Antigène: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp alpha KGDHC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-alpha KGDHC anticorps

Épitope: N-Term

Specificité: OGDH antibody was raised against the N terminal of OGDH

Purification: Affinity purified

Immunogène: OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OGDH Blocking Peptide, (ABIN5615117), is also available for use as a blocking control in assays to test for specificity of this OGDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur alpha KGDHC

Antigène: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Autre désignation: OGDH

Sujet: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 47 kDa (MW of target protein)