HSPA4 anticorps (N-Term)

N° du produit ABIN631620

Détail du produit anti-HSPA4 anticorps

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA4 antibody was raised against the N terminal of HSPA4

Purification: Affinity purified

Immunogène: HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA4 Blocking Peptide, catalog no. 33R-6956, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA4

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Autre désignation: HSPA4 (HSPA4 Produits)

Synonymes: anticorps APG-2, anticorps HS24/P52, anticorps HSPH2, anticorps RY, anticorps hsp70, anticorps hsp70RY, anticorps Hsp110, anticorps Hsp70, anticorps irp94, anticorps 70kDa, anticorps AI317151, anticorps Hsp70RY, anticorps mKIAA4025, anticorps hspa4, anticorps wu:fi30e11, anticorps zgc:55743, anticorps zgc:77413, anticorps hs24/p52, anticorps hspa4-a, anticorps osp94, anticorps pg-2, anticorps hspa4l, anticorps wu:fc41d05, anticorps wu:fi59h02, anticorps wu:fj35c08, anticorps zgc:55506, anticorps heat shock protein family A (Hsp70) member 4, anticorps heat shock protein family A member 4, anticorps heat shock protein 4, anticorps heat shock protein 4b, anticorps heat shock protein family A (Hsp70) member 4 S homeolog, anticorps heat shock protein 4a, anticorps HSPA4, anticorps Hspa4, anticorps hspa4b, anticorps hspa4.S, anticorps hspa4a

Sujet: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.

Poids moléculaire: 94 kDa (MW of target protein)