USP22 anticorps (N-Term)

N° du produit ABIN631622

L’anticorps anti-USP22 Polyclonal Lapin est utilisé pour la détection de USP22 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour USP22 anticorps (N-Term) (ABIN631622)

Antigène: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP22 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-USP22 anticorps

Épitope: N-Term

Specificité: USP22 antibody was raised against the N terminal of USP22

Purification: Affinity purified

Immunogène: USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP22 Blocking Peptide, (ABIN5616933), is also available for use as a blocking control in assays to test for specificity of this USP22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP22

Antigène: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Autre désignation: USP22

Sujet: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Poids moléculaire: 60 kDa (MW of target protein)