USP22 anticorps (Middle Region)
Aperçu rapide pour USP22 anticorps (Middle Region) (ABIN631627)
Antigène
Voir toutes USP22 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- USP22 antibody was raised against the middle region of USP22
-
Purification
- Affinity purified
-
Immunogène
- USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
-
-
anti-Ubiquitin Specific Peptidase 22 (USP22) antibody
USP22 Reactivité: Humain WB Hôte: Lapin Monoclonal unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) (AA 351-380), (C-Term) antibodyUSP22 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB4359 unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) (Middle Region) antibodyUSP22 Reactivité: Humain, Rat, Souris, Chien, Cobaye, Cheval, Boeuf (Vache), Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) (AA 330-478) antibodyUSP22 Reactivité: Humain ELISA, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) antibodyUSP22 Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 24GB2235 unconjugated Recombinant Antibody
anti-Ubiquitin Specific Peptidase 22 (USP22) antibodyUSP22 Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 24GB2475 unconjugated Recombinant Antibody
anti-Ubiquitin Specific Peptidase 22 (USP22) (AA 1-30), (N-Term) antibodyUSP22 Reactivité: Humain WB Hôte: Lapin Polyclonal RB4357 unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) antibodyUSP22 Reactivité: Humain WB Hôte: Souris Monoclonal 4C1 unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) (AA 121-220) antibodyUSP22 Reactivité: Humain, Rat, Xenopus laevis WB, ELISA, ICC, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Specific Peptidase 22 (USP22) (AA 216-265) antibodyUSP22 Reactivité: Humain, Rat, Souris, Xenopus laevis, Chien, Cobaye, Cheval, Boeuf (Vache), Lapin, Poulet, Singe WB Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
USP22 Blocking Peptide, (ABIN5616932), is also available for use as a blocking control in assays to test for specificity of this USP22 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
-
Autre désignation
- USP22
-
Sujet
- USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.
-
Poids moléculaire
- 60 kDa (MW of target protein)
Antigène
-
