CEACAM6 anticorps
-
- Antigène Voir toutes CEACAM6 Anticorps
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEACAM6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
- Top Product
- Discover our top product CEACAM6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CEACAM6 Blocking Peptide, catalog no. 33R-4544, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
- Autre désignation
- CEACAM6 (CEACAM6 Produits)
- Synonymes
- anticorps CD66c, anticorps CEAL, anticorps NCA, anticorps carcinoembryonic antigen-related cell adhesion molecule 6, anticorps carcinoembryonic antigen related cell adhesion molecule 6, anticorps Ceacam6, anticorps CEACAM6
- Sujet
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.
- Poids moléculaire
- 33 kDa (MW of target protein)
-