APRT anticorps (N-Term)
-
- Antigène Voir toutes APRT Anticorps
- APRT (Adenine Phosphoribosyltransferase (APRT))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APRT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- APRT antibody was raised against the N terminal of APRT
- Purification
- Affinity purified
- Immunogène
- APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
- Top Product
- Discover our top product APRT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APRT (Adenine Phosphoribosyltransferase (APRT))
- Autre désignation
- APRT (APRT Produits)
- Synonymes
- anticorps Tb07.43M14.200, anticorps Tb07.43M14.180, anticorps C85684, anticorps AMP, anticorps APRTD, anticorps adenine phosphoribosyltransferase, anticorps adenine phosphoribosyl transferase, anticorps CND05020, anticorps Tb927.7.1790, anticorps Tb927.7.1780, anticorps Arnit_0941, anticorps Saut_1231, anticorps Fbal_1180, anticorps PH_RS07970, anticorps PF_RS08760, anticorps PAB_RS02560, anticorps Aprt, anticorps APRT
- Sujet
- Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-