APRT anticorps (N-Term)

N° du produit ABIN631682

Détail du produit anti-APRT anticorps

Antigène: APRT (Adenine Phosphoribosyltransferase (APRT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APRT est non-conjugé

Application: Western Blotting (WB)

Specificité: APRT antibody was raised against the N terminal of APRT

Purification: Affinity purified

Immunogène: APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APRT

Antigène: APRT (Adenine Phosphoribosyltransferase (APRT))

Autre désignation: APRT (APRT Produits)

Synonymes: anticorps Tb07.43M14.200, anticorps Tb07.43M14.180, anticorps C85684, anticorps AMP, anticorps APRTD, anticorps adenine phosphoribosyltransferase, anticorps adenine phosphoribosyl transferase, anticorps CND05020, anticorps Tb927.7.1790, anticorps Tb927.7.1780, anticorps Arnit_0941, anticorps Saut_1231, anticorps Fbal_1180, anticorps PH_RS07970, anticorps PF_RS08760, anticorps PAB_RS02560, anticorps Aprt, anticorps APRT

Sujet: Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process