GNA12 anticorps

N° du produit ABIN631704

Détail du produit anti-GNA12 anticorps

Antigène: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNA12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNA12 Blocking Peptide, catalog no. 33R-9073, is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNA12

Antigène: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Autre désignation: GNA12 (GNA12 Produits)

Synonymes: anticorps NNX3, anticorps RMP, anticorps gep, anticorps gna12, anticorps gna12l, anticorps AI414047, anticorps AI504261, anticorps Galpha12, anticorps G protein subunit alpha 12, anticorps guanine nucleotide binding protein (G protein) alpha 12a, anticorps guanine nucleotide binding protein, alpha 12, anticorps GNA12, anticorps Gna12, anticorps gna12a

Sujet: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Poids moléculaire: 44 kDa (MW of target protein)