NET1 anticorps (N-Term)

N° du produit ABIN631712

Détail du produit anti-NET1 anticorps

Antigène: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NET1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NET1 antibody was raised against the N terminal of NET1

Purification: Affinity purified

Immunogène: NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NET1 Blocking Peptide, catalog no. 33R-7919, is also available for use as a blocking control in assays to test for specificity of this NET1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NET1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NET1

Antigène: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Autre désignation: NET1 (NET1 Produits)

Synonymes: anticorps arhgef8, anticorps net1a, anticorps xNET1, anticorps DKFZp459I0423, anticorps NET1, anticorps ARHGEF8, anticorps NET1A, anticorps 0610025H04Rik, anticorps 9530071N24Rik, anticorps AI604373, anticorps AU015857, anticorps Net1a, anticorps mNET1, anticorps wu:fb13g03, anticorps wu:fb25c11, anticorps zgc:92121, anticorps neuroepithelial cell transforming 1, anticorps neuroepithelial cell-transforming gene 1 protein, anticorps neuroepithelial cell transforming 1 L homeolog, anticorps neuroepithelial cell transforming gene 1, anticorps net1, anticorps EDI_348570, anticorps NET1, anticorps Net1, anticorps net1.L

Sujet: NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway