GPD1 anticorps
-
- Antigène Voir toutes GPD1 Anticorps
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
- Top Product
- Discover our top product GPD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPD1 Blocking Peptide, catalog no. 33R-9068, is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
- Autre désignation
- GPD1 (GPD1 Produits)
- Synonymes
- anticorps GPDH, anticorps Gpd3, anticorps GPD-C, anticorps GPDH-C, anticorps HTGTI, anticorps CG9042, anticorps DROGPDHA, anticorps DmG3PDH, anticorps Dmel\\CG9042, anticorps G3PDH, anticorps G3pdh, anticorps GAPDH, anticorps GPD, anticorps GPDA, anticorps GPDH-1, anticorps Gdh, anticorps Gpd, anticorps alpha-GPD, anticorps alpha-GPDH, anticorps alpha-GPDH-1, anticorps alpha-Gpdh, anticorps alphaGPDH, anticorps alphaGpd, anticorps alphaGpdh, anticorps alphaGpdh-1, anticorps gpdh, anticorps gpdh-1, anticorps sn-Gpdh, anticorps AI747587, anticorps Gdc-1, anticorps Gdc1, anticorps mKIAA4010, anticorps gpd1, anticorps wu:fc30a07, anticorps zgc:63859, anticorps MGC79676, anticorps GPD1, anticorps LG3P, anticorps zgc:112197, anticorps Gpd1, anticorps gpd1h, anticorps gpd1l, anticorps wu:fc58b05, anticorps zgc:66051, anticorps zgc:85742, anticorps glycerol-3-phosphate dehydrogenase 1, anticorps Glycerol-3-phosphate dehydrogenase [NAD(+)], anticorps glycerol-3-phosphate dehydrogenase, anticorps Glycerol 3 phosphate dehydrogenase, anticorps glycerol-3-phosphate dehydrogenase 1 (soluble), anticorps glycerol-3-phosphate dehydrogenase 1 L homeolog, anticorps glycerol-3-phosphate dehydrogenase 1c, anticorps glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, anticorps glycerol-3-phosphate dehydrogenase 1a, anticorps glycerol-3-phosphate dehydrogenase 1b, anticorps Gpd1, anticorps gpdh-1, anticorps GPD1, anticorps Tb11.02.5280, anticorps Gpdh, anticorps gpd1.L, anticorps gpd1c, anticorps gpd1, anticorps LOC101071719, anticorps gpd1a, anticorps gpd1b
- Sujet
- GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
- Poids moléculaire
- 37 kDa (MW of target protein)
-