SUMO3 anticorps

N° du produit ABIN631719

Cet anticorps anti-SUMO3 Polyclonal Lapin (ABIN631719) détecte spécifiquement SUMO3 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SUMO3 anticorps (ABIN631719)

Antigène: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUMO3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SUMO3 anticorps

Purification: Affinity purified

Immunogène: SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUMO3 Blocking Peptide, (ABIN5616458), is also available for use as a blocking control in assays to test for specificity of this SUMO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUMO3

Antigène: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Autre désignation: SUMO3

Sujet: SUMO proteins, such as SUMO3, and ubiquitin posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.

Poids moléculaire: 12 kDa (MW of target protein)