Crossover junction endonuclease EME1 (EME1) anticorps

N° du produit ABIN631739

Détail du produit

Antigène: Crossover junction endonuclease EME1 (EME1)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EME1 Blocking Peptide, catalog no. 33R-1632, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Crossover junction endonuclease EME1 (EME1)

Autre désignation: EME1 (EME1 Produits)

Synonymes: anticorps 6820428D13, anticorps essential meiotic structure-specific endonuclease 1, anticorps Eme1

Sujet: EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Poids moléculaire: 63 kDa (MW of target protein)