SAR1B anticorps

N° du produit ABIN631740

Cet anticorps anti-SAR1B Polyclonal Lapin (ABIN631740) détecte spécifiquement SAR1B dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SAR1B anticorps (ABIN631740)

Antigène: SAR1B (SAR1 Homolog B (SAR1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAR1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAR1B anticorps

Purification: Affinity purified

Immunogène: SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAR1B Blocking Peptide, (ABIN5615997), is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAR1B

Antigène: SAR1B (SAR1 Homolog B (SAR1B))

Autre désignation: SAR1B

Sujet: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Lipid Metabolism