SAR1B anticorps

N° du produit ABIN631740

Détail du produit anti-SAR1B anticorps

Antigène: SAR1B (SAR1 Homolog B (SAR1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAR1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAR1B Blocking Peptide, catalog no. 33R-8038, is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAR1B

Antigène: SAR1B (SAR1 Homolog B (SAR1B))

Autre désignation: SAR1B (SAR1B Produits)

Synonymes: anticorps SAR1, anticorps SAR1B, anticorps SARA2, anticorps 2310075M17Rik, anticorps 2900019I22Rik, anticorps CMRD, anticorps Sara1b, anticorps Sara2, anticorps Sarb, anticorps cmrd, anticorps gtbpb, anticorps sar1a, anticorps sara2, anticorps SARA1B, anticorps ANDD, anticorps GTBPB, anticorps zgc:73204, anticorps secretion associated Ras related GTPase 1B, anticorps hypothetical protein, anticorps SAR1 homolog B (S. cerevisiae), anticorps secretion associated, Ras related GTPase 1B L homeolog, anticorps secretion associated, Ras related GTPase 1B, anticorps SAR1B, anticorps Sar1B, anticorps sar1b, anticorps Sar1b, anticorps sar1b.L

Sujet: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Lipid Metabolism