Crossover junction endonuclease EME1 (EME1) anticorps

N° du produit ABIN631761

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour Crossover junction endonuclease EME1 (EME1) anticorps (ABIN631761)

Antigène: Crossover junction endonuclease EME1 (EME1)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Purification: Affinity purified

Immunogène: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EME1 Blocking Peptide, (ABIN5613363), is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Crossover junction endonuclease EME1 (EME1)

Autre désignation: EME1

Sujet: EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Poids moléculaire: 63 kDa (MW of target protein)