PRPSAP2 anticorps (N-Term)

N° du produit ABIN631768

Détail du produit anti-PRPSAP2 anticorps

Antigène: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRPSAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRPSAP2 antibody was raised against the N terminal of PRPSAP2

Purification: Affinity purified

Immunogène: PRPSAP2 antibody was raised using the N terminal of PRPSAP2 corresponding to a region with amino acids MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPSAP2 Blocking Peptide, catalog no. 33R-5987, is also available for use as a blocking control in assays to test for specificity of this PRPSAP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPSAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRPSAP2

Antigène: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Autre désignation: PRPSAP2 (PRPSAP2 Produits)

Synonymes: anticorps PAP41, anticorps A230054F23Rik, anticorps Pap41, anticorps phosphoribosyl pyrophosphate synthetase associated protein 2, anticorps phosphoribosyl pyrophosphate synthetase-associated protein 2, anticorps PRPSAP2, anticorps Prpsap2

Sujet: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD.

Poids moléculaire: 41 kDa (MW of target protein)