Lipin 1 anticorps (N-Term)

N° du produit ABIN631777

Détail du produit anti-Lipin 1 anticorps

Antigène: Lipin 1 (LPIN1)

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lipin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Lipin 1 antibody was raised against the N terminal of LPIN1

Purification: Affinity purified

Immunogène: Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipin 1 Blocking Peptide, catalog no. 33R-8579, is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lipin 1

Antigène: Lipin 1 (LPIN1)

Autre désignation: Lipin 1 (LPIN1 Produits)

Synonymes: anticorps LPIN1, anticorps pap1, anticorps PAP1, anticorps 4631420P06, anticorps Kiaa0188, anticorps Lipin1, anticorps fld, anticorps mKIAA0188, anticorps zgc:194552, anticorps zgc:194558, anticorps lipin1, anticorps lipin 1, anticorps phosphatidate phosphatase LPIN1, anticorps LPIN1, anticorps lpin1, anticorps LOC100539289, anticorps Lpin1

Sujet: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process