TMPRSS3 anticorps (N-Term)

N° du produit ABIN631830

Cet anticorps anti-TMPRSS3 est un anticorps Lapin Polyclonal détectant TMPRSS3 dans WB. Adapté pour Humain.

Aperçu rapide pour TMPRSS3 anticorps (N-Term) (ABIN631830)

Antigène: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMPRSS3 anticorps

Épitope: N-Term

Specificité: TMPRSS3 antibody was raised against the N terminal of TMPRSS3

Purification: Affinity purified

Immunogène: TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS3 Blocking Peptide, (ABIN5616696), is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS3

Antigène: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Autre désignation: TMPRSS3

Sujet: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Sensory Perception of Sound