RAD23B anticorps

N° du produit ABIN631880

L’anticorps Lapin Polyclonal anti-RAD23B a été validé pour WB. Il convient pour détecter RAD23B dans des échantillons de Humain.

Aperçu rapide pour RAD23B anticorps (ABIN631880)

Antigène: RAD23B (RAD23 Homolog B (RAD23B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD23B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAD23B anticorps

Purification: Affinity purified

Immunogène: RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD23B Blocking Peptide, (ABIN5615733), is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD23B

Antigène: RAD23B (RAD23 Homolog B (RAD23B))

Autre désignation: RAD23B

Sujet: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Réparation de l'ADN