RAD23B anticorps

N° du produit ABIN631882

Détail du produit anti-RAD23B anticorps

Antigène: RAD23B (RAD23 Homolog B (RAD23B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD23B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD23B Blocking Peptide, catalog no. 33R-7658, is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD23B

Antigène: RAD23B (RAD23 Homolog B (RAD23B))

Autre désignation: RAD23B (RAD23B Produits)

Synonymes: anticorps HHR23B, anticorps HR23B, anticorps P58, anticorps 0610007D13Rik, anticorps AV001138, anticorps mHR23B, anticorps p58, anticorps MGC107846, anticorps zgc:65951, anticorps RAD23 homolog B, nucleotide excision repair protein, anticorps UV excision repair protein RAD23 homolog B, anticorps RAD23 homolog B, nucleotide excision repair protein S homeolog, anticorps RAD23B, anticorps Rad23b, anticorps rd23b, anticorps rad23b, anticorps rad23b.S

Sujet: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Réparation de l'ADN