WDR55 anticorps (Middle Region)

N° du produit ABIN631883

Détail du produit anti-WDR55 anticorps

Antigène: WDR55 (WD Repeat Domain 55 (WDR55))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR55 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR55 antibody was raised against the middle region of WDR55

Purification: Affinity purified

Immunogène: WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR55 Blocking Peptide, catalog no. 33R-1298, is also available for use as a blocking control in assays to test for specificity of this WDR55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR55

Antigène: WDR55 (WD Repeat Domain 55 (WDR55))

Autre désignation: WDR55 (WDR55 Produits)

Synonymes: anticorps MGC146726, anticorps 2410080P20Rik, anticorps C80692, anticorps LRRG00133, anticorps RGD1305640, anticorps flj20195l, anticorps zgc:111796, anticorps WD repeat domain 55, anticorps WDR55, anticorps wdr55, anticorps Wdr55

Sujet: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Poids moléculaire: 42 kDa (MW of target protein)