ERCC5 anticorps (N-Term)

N° du produit ABIN631899

Cet anticorps anti-ERCC5 est un anticorps Lapin Polyclonal détectant ERCC5 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ERCC5 anticorps (N-Term) (ABIN631899)

Antigène: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERCC5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERCC5 anticorps

Épitope: N-Term

Specificité: ERCC5 antibody was raised against the N terminal of ERCC5

Purification: Affinity purified

Immunogène: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERCC5 Blocking Peptide, (ABIN5613393), is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERCC5

Antigène: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Autre désignation: ERCC5

Sujet: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Poids moléculaire: 133 kDa (MW of target protein)

Pathways: Réparation de l'ADN