ERCC5 anticorps (N-Term)

N° du produit ABIN631899

Détail du produit anti-ERCC5 anticorps

Antigène: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERCC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ERCC5 antibody was raised against the N terminal of ERCC5

Purification: Affinity purified

Immunogène: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERCC5

Antigène: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Autre désignation: ERCC5 (ERCC5 Produits)

Synonymes: anticorps COFS3, anticorps ERCM2, anticorps UVDR, anticorps XPG, anticorps XPGC, anticorps cofs3, anticorps ercm2, anticorps uvdr, anticorps xpg, anticorps xpgc, anticorps Xpg, anticorps ERCC excision repair 5, endonuclease, anticorps excision repair cross-complementation group 5 L homeolog, anticorps excision repair cross-complementing rodent repair deficiency, complementation group 5, anticorps ERCC5, anticorps ercc5.L, anticorps Ercc5

Sujet: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Poids moléculaire: 133 kDa (MW of target protein)

Pathways: Réparation de l'ADN