FANCA anticorps (N-Term)

N° du produit ABIN631910

Détail du produit anti-FANCA anticorps

Antigène: FANCA (Fanconi Anemia Group A Protein (FANCA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FANCA est non-conjugé

Application: Western Blotting (WB)

Specificité: FANCA antibody was raised against the N terminal of FANCA

Purification: Affinity purified

Immunogène: FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FANCA

Antigène: FANCA (Fanconi Anemia Group A Protein (FANCA))

Autre désignation: FANCA (FANCA Produits)

Synonymes: anticorps FA, anticorps FA-H, anticorps FA1, anticorps FAA, anticorps FACA, anticorps FAH, anticorps FANCH, anticorps AW208693, anticorps Fanconi anemia complementation group A, anticorps Fanconi anemia, complementation group A, anticorps FANCA, anticorps Fanca

Sujet: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Réparation de l'ADN