FANCA anticorps (N-Term)

N° du produit ABIN631910

L’anticorps anti-FANCA Polyclonal Lapin est utilisé pour la détection de FANCA dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FANCA anticorps (N-Term) (ABIN631910)

Antigène: FANCA (Fanconi Anemia Group A Protein (FANCA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FANCA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FANCA anticorps

Épitope: N-Term

Specificité: FANCA antibody was raised against the N terminal of FANCA

Purification: Affinity purified

Immunogène: FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FANCA Blocking Peptide, (ABIN939926), is also available for use as a blocking control in assays to test for specificity of this FANCA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FANCA

Antigène: FANCA (Fanconi Anemia Group A Protein (FANCA))

Autre désignation: FANCA

Sujet: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Réparation de l'ADN