PFDN6 anticorps (N-Term)

N° du produit ABIN631922

L’anticorps Lapin Polyclonal anti-PFDN6 a été validé pour WB. Il convient pour détecter PFDN6 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour PFDN6 anticorps (N-Term) (ABIN631922)

Antigène: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFDN6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PFDN6 anticorps

Épitope: N-Term

Specificité: PFDN6 antibody was raised against the N terminal of PFDN6

Purification: Affinity purified

Immunogène: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PFDN6 Blocking Peptide, (ABIN5615323), is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFDN6

Antigène: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Autre désignation: PFDN6

Sujet: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response